PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr7P08050_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 266aa    MW: 30276.3 Da    PI: 5.8398
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr7P08050_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.11.7e-091892242055
                            HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
               Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                            +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  GSMUA_Achr7P08050_001 189 YKWPYPSETEKMALAESTGLDQKQINNWFINQRKRH 224
                            4679*****************************885 PP

2ELK35.12.9e-12144165122
                    ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                            ELKh+Ll+KY+gyL++L++E+s
  GSMUA_Achr7P08050_001 144 ELKHHLLKKYGGYLSTLRKELS 165
                            9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.8E-18246IPR005540KNOX1
PfamPF037903.9E-21442IPR005540KNOX1
SMARTSM012565.7E-2350101IPR005541KNOX2
PfamPF037916.3E-2356100IPR005541KNOX2
PfamPF037891.3E-9144165IPR005539ELK domain
PROSITE profilePS5121311.243144164IPR005539ELK domain
SMARTSM011888.8E-7144165IPR005539ELK domain
PROSITE profilePS5007113.102164227IPR001356Homeobox domain
SuperFamilySSF466892.91E-19165240IPR009057Homeodomain-like
SMARTSM003897.0E-12166231IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.6E-26169229IPR009057Homeodomain-like
CDDcd000861.44E-13176228No hitNo description
PfamPF059207.5E-17184223IPR008422Homeobox KN domain
PROSITE patternPS000270202225IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MEEIKAKIMS HPQYSTLVGA FMDCQKVGAP PEVVTRLSAI VHDVSPGPGC HNDGSPDPDL  60
DQFMESYCDM LVKYRQELTK PLQEATNFLK KMESQFNALT DSSTRGLFPS DEICEGVGSS  120
EEDQDAGGGE ADLPEVDPHA EDKELKHHLL KKYGGYLSTL RKELSKKKKK EKLPKDARQK  180
LLNWWELHYK WPYPSETEKM ALAESTGLDQ KQINNWFINQ RKRHWKPSED MQFVVMDGFH  240
PRNASSASAL FMDGQFMVDG MFRFGP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009407695.10.0PREDICTED: homeobox protein rough sheath 1-like isoform X1
RefseqXP_009407694.10.0PREDICTED: homeobox protein rough sheath 1-like isoform X1
SwissprotQ413301e-125KN1_SOLLC; Homeotic protein knotted-1
SwissprotO041351e-124KNAP2_MALDO; Homeobox protein knotted-1-like 2
TrEMBLM0TFP50.0M0TFP5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P08050_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40613873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-101KNOTTED-like from Arabidopsis thaliana